Lineage for d2h8ha3 (2h8h A:249-523)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2979972Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2980081Species Human (Homo sapiens) [TaxId:9606] [56156] (14 PDB entries)
  8. 2980098Domain d2h8ha3: 2h8h A:249-523 [147242]
    Other proteins in same PDB: d2h8ha1, d2h8ha2, d2h8ha4
    automated match to d1fmka3
    complexed with h8h

Details for d2h8ha3

PDB Entry: 2h8h (more details), 2.2 Å

PDB Description: src kinase in complex with a quinazoline inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d2h8ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8ha3 d.144.1.7 (A:249-523) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftst

SCOPe Domain Coordinates for d2h8ha3:

Click to download the PDB-style file with coordinates for d2h8ha3.
(The format of our PDB-style files is described here.)

Timeline for d2h8ha3: