Lineage for d2h8ha1 (2h8h A:85-145)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783503Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 1783518Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries)
  8. 1783522Domain d2h8ha1: 2h8h A:85-145 [147240]
    Other proteins in same PDB: d2h8ha2, d2h8ha3
    automated match to d1fmka1
    complexed with h8h

Details for d2h8ha1

PDB Entry: 2h8h (more details), 2.2 Å

PDB Description: src kinase in complex with a quinazoline inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d2h8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8ha1 b.34.2.1 (A:85-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsiq
a

SCOPe Domain Coordinates for d2h8ha1:

Click to download the PDB-style file with coordinates for d2h8ha1.
(The format of our PDB-style files is described here.)

Timeline for d2h8ha1: