![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein c-src protein tyrosine kinase [50064] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries) |
![]() | Domain d2h8ha1: 2h8h A:85-145 [147240] Other proteins in same PDB: d2h8ha2, d2h8ha3 automated match to d1fmka1 complexed with h8h |
PDB Entry: 2h8h (more details), 2.2 Å
SCOPe Domain Sequences for d2h8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h8ha1 b.34.2.1 (A:85-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsiq a
Timeline for d2h8ha1: