SCOP 1.75: Domain d2h8aa1: 2h8a A:9-147

Lineage for d2h8aa1 (2h8a A:9-147)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.56: MAPEG domain-like [161083] (1 superfamily)
   4 helices, bundle; left-handed superhelix

4. Superfamily f.56.1: MAPEG domain-like [161084] (1 family)

5. Family f.56.1.1: MAPEG domain [161085] (3 proteins)
   Pfam PF01124

6. Protein Microsomal glutathione S-transferase 1 [161088] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [161089] (1 PDB entry)
   Uniprot P08011 10-148

8. Domain d2h8aa1: 2h8a A:9-147 [147239]
   complexed with gtt

Details for d2h8aa1

PDB Entry: 2h8a, 3.2 Å

PDB Description: Structure of Microsomal Glutathione Transferase 1 in Complex with Glutathione

PDB Compounds: (A:) Microsomal glutathione S-transferase 1

SCOP Domain Sequences for d2h8aa1:

Sequence, based on SEQRES records:

>d2h8aa1 f.56.1.1 (A:9-147) Microsomal glutathione S-transferase 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
nevlmaftsyatiilakmmflssatafqrltnkvfanpedcagfgkgenakkflrtdekv
ervrrahlndlenivpflgigllyslsgpdlstalihfrifvgariyhtiayltplpqpn
rglaffvgygvtlsmayrl

Sequence, based on observed residues (ATOM records):

>d2h8aa1 f.56.1.1 (A:9-147) Microsomal glutathione S-transferase 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
nevlmaftsyatiilakmmflssatafqrltnkvflrtdekvervrrahlndlenivpfl
gigllyslsgpdlstalihfrifvgariyhtiayltplpqpnrglaffvgygvtlsmayr
l

Timeline for d2h8aa1:

• d2h8aa1 is new in SCOP 1.75
  
• d2h8aa1 appears in SCOPe 2.01
  
• d2h8aa1 appears in the current release, SCOPe 2.08