![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.56: MAPEG domain-like [161083] (1 superfamily) 4 helices, bundle; left-handed superhelix |
![]() | Superfamily f.56.1: MAPEG domain-like [161084] (1 family) ![]() |
![]() | Family f.56.1.1: MAPEG domain [161085] (3 proteins) Pfam PF01124 |
![]() | Protein Microsomal glutathione S-transferase 1 [161088] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [161089] (1 PDB entry) Uniprot P08011 10-148 |
![]() | Domain d2h8aa1: 2h8a A:9-147 [147239] complexed with gtt |
PDB Entry: 2h8a (more details), 3.2 Å
SCOP Domain Sequences for d2h8aa1:
Sequence, based on SEQRES records: (download)
>d2h8aa1 f.56.1.1 (A:9-147) Microsomal glutathione S-transferase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} nevlmaftsyatiilakmmflssatafqrltnkvfanpedcagfgkgenakkflrtdekv ervrrahlndlenivpflgigllyslsgpdlstalihfrifvgariyhtiayltplpqpn rglaffvgygvtlsmayrl
>d2h8aa1 f.56.1.1 (A:9-147) Microsomal glutathione S-transferase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} nevlmaftsyatiilakmmflssatafqrltnkvflrtdekvervrrahlndlenivpfl gigllyslsgpdlstalihfrifvgariyhtiayltplpqpnrglaffvgygvtlsmayr l
Timeline for d2h8aa1: