SCOPe 2.06: Domain d2h80a1: 2h80 A:17-81

Lineage for d2h80a1 (2h80 A:17-81)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
   shares a sequence motif with Pfam PF07647, but has a distinct packing of helices

6. Protein Deleted in Liver Cancer 2, DLC2 [158527] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158528] (2 PDB entries)
   Uniprot Q9Y3M8 50-120

8. Domain d2h80a1: 2h80 A:17-81 [147238]
   Other proteins in same PDB: d2h80a2

Details for d2h80a1

PDB Entry: 2h80

PDB Description: nmr structures of sam domain of deleted in liver cancer 2 (dlc2)

PDB Compounds: (A:) StAR-related lipid transfer protein 13

SCOPe Domain Sequences for d2h80a1:

Sequence; same for both SEQRES and ATOM records:

>d2h80a1 a.60.1.3 (A:17-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]}
qeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdflekdlveplcrrlntlnk
casmk

Timeline for d2h80a1:

• d2h80a1 first appeared in SCOP 1.75
  
• d2h80a1 appears in SCOPe 2.05
  
• d2h80a1 appears in SCOPe 2.07
  
• d2h80a1 appears in the current release, SCOPe 2.08