Lineage for d2h80a1 (2h80 A:17-81)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715562Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
    shares a sequence motif with Pfam PF07647, but has a distinct packing of helices
  6. 2715567Protein Deleted in Liver Cancer 2, DLC2 [158527] (1 species)
  7. 2715568Species Human (Homo sapiens) [TaxId:9606] [158528] (2 PDB entries)
    Uniprot Q9Y3M8 50-120
  8. 2715569Domain d2h80a1: 2h80 A:17-81 [147238]
    Other proteins in same PDB: d2h80a2

Details for d2h80a1

PDB Entry: 2h80 (more details)

PDB Description: nmr structures of sam domain of deleted in liver cancer 2 (dlc2)
PDB Compounds: (A:) StAR-related lipid transfer protein 13

SCOPe Domain Sequences for d2h80a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h80a1 a.60.1.3 (A:17-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]}
qeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdflekdlveplcrrlntlnk
casmk

SCOPe Domain Coordinates for d2h80a1:

Click to download the PDB-style file with coordinates for d2h80a1.
(The format of our PDB-style files is described here.)

Timeline for d2h80a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h80a2