SCOPe 2.08: Domain d2h7ba1: 2h7b A:1-103

Lineage for d2h7ba1 (2h7b A:1-103)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.277: TAFH domain-like [158552] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.277.1: TAFH domain-like [158553] (1 family)
   automatically mapped to Pfam PF07531

5. Family a.277.1.1: TAFH domain-like [158554] (2 proteins)
   Pfam PF07531

6. Protein ETO [158557] (1 species)
   Synonyms: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2

7. Species Human (Homo sapiens) [TaxId:9606] [158558] (3 PDB entries)
   Uniprot Q06455 119-225! Uniprot Q06455 120-222

8. Domain d2h7ba1: 2h7b A:1-103 [147237]
   Other proteins in same PDB: d2h7ba2

Details for d2h7ba1

PDB Entry: 2h7b

PDB Description: solution structure of the etafh domain from the human leukemia- associated fusion protein aml1-eto

PDB Compounds: (A:) Core-binding factor, ML1-ETO

SCOPe Domain Sequences for d2h7ba1:

Sequence; same for both SEQRES and ATOM records:

>d2h7ba1 a.277.1.1 (A:1-103) ETO {Human (Homo sapiens) [TaxId: 9606]}
arqlsklkrflttlqqfgndispeigervrtlvlglvnstltieefhsklqeatnfplrp
fvipflkanlpllqrellhaarlakqnpaqylaqheqllldas

Timeline for d2h7ba1:

• d2h7ba1 first appeared in SCOP 1.75
  
• d2h7ba1 appears in SCOPe 2.07