Lineage for d2h7aa1 (2h7a A:3-110)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617207Fold d.350: YcgL-like [160190] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet, order:3124
  4. 2617208Superfamily d.350.1: YcgL-like [160191] (1 family) (S)
  5. 2617209Family d.350.1.1: YcgL-like [160192] (1 protein)
    Pfam PF05166
  6. 2617210Protein Hypothetical protein YcgL [160193] (1 species)
  7. 2617211Species Escherichia coli [TaxId:562] [160194] (1 PDB entry)
    Uniprot Q2LD68 1-108
  8. 2617212Domain d2h7aa1: 2h7a A:3-110 [147236]
    Other proteins in same PDB: d2h7aa2

Details for d2h7aa1

PDB Entry: 2h7a (more details)

PDB Description: NMR Structure of the Conserved Protein YcgL from Escherichia coli representing the DUF709 Family Reveals a Novel a/b/a Sandwich Fold
PDB Compounds: (A:) Hypothetical protein ycgL

SCOPe Domain Sequences for d2h7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h7aa1 d.350.1.1 (A:3-110) Hypothetical protein YcgL {Escherichia coli [TaxId: 562]}
mpkpgilksksmfcviyrsskrdqtylyvekkddfsrvpeelmkgfgqpqlamilpldgr
kklvnadiekvkqalteqgyylqlppppedllkqhlsvmgqktddtnk

SCOPe Domain Coordinates for d2h7aa1:

Click to download the PDB-style file with coordinates for d2h7aa1.
(The format of our PDB-style files is described here.)

Timeline for d2h7aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h7aa2