SCOPe 2.07: Domain d2h7aa1: 2h7a A:3-110

Lineage for d2h7aa1 (2h7a A:3-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.350: YcgL-like [160190] (1 superfamily)
   beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet, order:3124

4. Superfamily d.350.1: YcgL-like [160191] (1 family)

5. Family d.350.1.1: YcgL-like [160192] (1 protein)
   Pfam PF05166

6. Protein Hypothetical protein YcgL [160193] (1 species)

7. Species Escherichia coli [TaxId:562] [160194] (1 PDB entry)
   Uniprot Q2LD68 1-108

8. Domain d2h7aa1: 2h7a A:3-110 [147236]
   Other proteins in same PDB: d2h7aa2

Details for d2h7aa1

PDB Entry: 2h7a

PDB Description: NMR Structure of the Conserved Protein YcgL from Escherichia coli representing the DUF709 Family Reveals a Novel a/b/a Sandwich Fold

PDB Compounds: (A:) Hypothetical protein ycgL

SCOPe Domain Sequences for d2h7aa1:

Sequence; same for both SEQRES and ATOM records:

>d2h7aa1 d.350.1.1 (A:3-110) Hypothetical protein YcgL {Escherichia coli [TaxId: 562]}
mpkpgilksksmfcviyrsskrdqtylyvekkddfsrvpeelmkgfgqpqlamilpldgr
kklvnadiekvkqalteqgyylqlppppedllkqhlsvmgqktddtnk

Timeline for d2h7aa1:

• d2h7aa1 first appeared in SCOP 1.75
  
• d2h7aa1 appears in SCOPe 2.06
  
• d2h7aa1 appears in the current release, SCOPe 2.08