Lineage for d2h5na1 (2h5n A:1-132)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781439Fold a.287: TerB-like [158681] (1 superfamily)
    multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry
  4. 781440Superfamily a.287.1: TerB-like [158682] (2 families) (S)
    members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure
  5. 781446Family a.287.1.2: PG1108-like [158686] (1 protein)
  6. 781447Protein Hypothetical protein PG1108 [158687] (1 species)
  7. 781448Species Porphyromonas gingivalis [TaxId:837] [158688] (1 PDB entry)
    Uniprot Q7MVF6 1-132
  8. 781449Domain d2h5na1: 2h5n A:1-132 [147227]
    complexed with mg

Details for d2h5na1

PDB Entry: 2h5n (more details), 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function PG1108 from Porphyromonas gingivalis W83
PDB Compounds: (A:) Hypothetical protein PG_1108

SCOP Domain Sequences for d2h5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5na1 a.287.1.2 (A:1-132) Hypothetical protein PG1108 {Porphyromonas gingivalis [TaxId: 837]}
mglgrqslnimtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdll
lkasdsieasqavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglpt
mtvmeainnmkn

SCOP Domain Coordinates for d2h5na1:

Click to download the PDB-style file with coordinates for d2h5na1.
(The format of our PDB-style files is described here.)

Timeline for d2h5na1: