SCOPe 2.07: Domain d2h4oc_: 2h4o C:

Lineage for d2h4oc_ (2h4o C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.368: YonK-like [160569] (1 superfamily)
   intertwined dimer of beta(3)-alpha-beta subunits; assembles further in octamer with formation of a wide 16-stranded beta-barrel

4. Superfamily d.368.1: YonK-like [160570] (1 family)
   (Pro)phage and phage-related proteins
   automatically mapped to Pfam PF09642

5. Family d.368.1.1: Yonk-like [160571] (1 protein)
   Pfam PF09642

6. Protein Uncharacterized protein YonK [160572] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160573] (1 PDB entry)
   Uniprot O31947 2-63

8. Domain d2h4oc_: 2h4o C: [147225]
   automated match to d2h4oa1

Details for d2h4oc_

PDB Entry: 2h4o, 2.8 Å

PDB Description: X-ray Crystal Structure of Protein yonK from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR415

PDB Compounds: (C:) YonK protein

SCOPe Domain Sequences for d2h4oc_:

Sequence; same for both SEQRES and ATOM records:

>d2h4oc_ d.368.1.1 (C:) Uncharacterized protein YonK {Bacillus subtilis [TaxId: 1423]}
askkvhqinvkgffdmdvmevteqtkeaeytydfkeilsefngknvsitvkeenelpvkg
ve

Timeline for d2h4oc_:

• d2h4oc_ first appeared in SCOP 1.75, called d2h4oc1
  
• d2h4oc_ appears in SCOPe 2.06
  
• d2h4oc_ appears in the current release, SCOPe 2.08