Lineage for d2h4oa1 (2h4o A:2-63)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883030Fold d.368: YonK-like [160569] (1 superfamily)
    intertwined dimer of beta(3)-alpha-beta subunits; assembles further in octamer with formation of a wide 16-stranded beta-barrel
  4. 883031Superfamily d.368.1: YonK-like [160570] (1 family) (S)
    (Pro)phage and phage-related proteins
  5. 883032Family d.368.1.1: Yonk-like [160571] (1 protein)
    Pfam PF09642
  6. 883033Protein Uncharacterized protein YonK [160572] (1 species)
  7. 883034Species Bacillus subtilis [TaxId:1423] [160573] (1 PDB entry)
    Uniprot O31947 2-63
  8. 883035Domain d2h4oa1: 2h4o A:2-63 [147223]

Details for d2h4oa1

PDB Entry: 2h4o (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein yonK from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR415
PDB Compounds: (A:) YonK protein

SCOP Domain Sequences for d2h4oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4oa1 d.368.1.1 (A:2-63) Uncharacterized protein YonK {Bacillus subtilis [TaxId: 1423]}
askkvhqinvkgffdmdvmevteqtkeaeytydfkeilsefngknvsitvkeenelpvkg
ve

SCOP Domain Coordinates for d2h4oa1:

Click to download the PDB-style file with coordinates for d2h4oa1.
(The format of our PDB-style files is described here.)

Timeline for d2h4oa1: