Lineage for d2h3ja1 (2h3j A:1-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782726Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2782792Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2782819Protein Hypothetical protein PA4359 [159016] (1 species)
  7. 2782820Species Pseudomonas aeruginosa [TaxId:287] [159017] (1 PDB entry)
    Uniprot Q9HW42 1-75
  8. 2782821Domain d2h3ja1: 2h3j A:1-75 [147217]

Details for d2h3ja1

PDB Entry: 2h3j (more details)

PDB Description: solution nmr structure of protein pa4359 from pseudomonas aeruginosa: northeast structural genomics consortium target pat89
PDB Compounds: (A:) Hypothetical protein PA4359

SCOPe Domain Sequences for d2h3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ja1 b.34.1.2 (A:1-75) Hypothetical protein PA4359 {Pseudomonas aeruginosa [TaxId: 287]}
msalqpsrsyritgyspaisngyrqrlfsmgllpgaalrvvriaplgdpiqvetrqtsla
lrrkdlalltlvpld

SCOPe Domain Coordinates for d2h3ja1:

Click to download the PDB-style file with coordinates for d2h3ja1.
(The format of our PDB-style files is described here.)

Timeline for d2h3ja1: