![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (5 proteins) |
![]() | Protein Hypothetical protein PA4359 [159016] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [159017] (1 PDB entry) Uniprot Q9HW42 1-75 |
![]() | Domain d2h3ja1: 2h3j A:1-75 [147217] |
PDB Entry: 2h3j (more details)
SCOPe Domain Sequences for d2h3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3ja1 b.34.1.2 (A:1-75) Hypothetical protein PA4359 {Pseudomonas aeruginosa [TaxId: 287]} msalqpsrsyritgyspaisngyrqrlfsmgllpgaalrvvriaplgdpiqvetrqtsla lrrkdlalltlvpld
Timeline for d2h3ja1: