SCOPe 2.08: Domain d2h1tb_: 2h1t B:

Lineage for d2h1tb_ (2h1t B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.178: Spiral beta-roll [159274] (1 superfamily)
   a large 15-stranded beta-sheet rolled about a single helix core; overlapping edges form a sandwich-like structure; topological similarity to the LolA-like fold (89391)

4. Superfamily b.178.1: PA1994-like [159275] (1 family)
   automatically mapped to Pfam PF06475

5. Family b.178.1.1: PA1994-like [159276] (1 protein)
   Pfam PF06475; DUF1089

6. Protein Hypothetical protein PA1994 [159277] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159278] (1 PDB entry)
   Uniprot Q9I2B5 2-187

8. Domain d2h1tb_: 2h1t B: [147216]
   automated match to d2h1ta1
   complexed with edo, mpd

Details for d2h1tb_

PDB Entry: 2h1t, 1.8 Å

PDB Description: crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2h1tb_:

Sequence; same for both SEQRES and ATOM records:

>d2h1tb_ b.178.1.1 (B:) Hypothetical protein PA1994 {Pseudomonas aeruginosa [TaxId: 287]}
drlytwaglwrspssswealrleddqaesqlrapdersglpyqldyrlrwdadwhlreav
fhvesetgvrklhlladgrghwqdgdgealpafdgcldidiwpspftntfpirrlgladg
qraeiralyieapaleprsmrqaytrldashylyenlegsafkavllvdeqglvidypgl
fqrl

Timeline for d2h1tb_:

• d2h1tb_ first appeared in SCOP 1.75, called d2h1tb1
  
• d2h1tb_ appears in SCOPe 2.07