Class b: All beta proteins [48724] (177 folds) |
Fold b.178: Spiral beta-roll [159274] (1 superfamily) a large 15-stranded beta-sheet rolled about a single helix core; overlapping edges form a sandwich-like structure; topological similarity to the LolA-like fold (89391) |
Superfamily b.178.1: PA1994-like [159275] (1 family) automatically mapped to Pfam PF06475 |
Family b.178.1.1: PA1994-like [159276] (1 protein) Pfam PF06475; DUF1089 |
Protein Hypothetical protein PA1994 [159277] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [159278] (1 PDB entry) Uniprot Q9I2B5 2-187 |
Domain d2h1ta1: 2h1t A:2-187 [147215] N-terminal strand-swapped dimer complexed with edo, mpd |
PDB Entry: 2h1t (more details), 1.8 Å
SCOPe Domain Sequences for d2h1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1ta1 b.178.1.1 (A:2-187) Hypothetical protein PA1994 {Pseudomonas aeruginosa [TaxId: 287]} srdrlytwaglwrspssswealrleddqaesqlrapdersglpyqldyrlrwdadwhlre avfhvesetgvrklhlladgrghwqdgdgealpafdgcldidiwpspftntfpirrlgla dgqraeiralyieapaleprsmrqaytrldashylyenlegsafkavllvdeqglvidyp glfqrl
Timeline for d2h1ta1: