SCOPe 2.06: Domain d2h1ta1: 2h1t A:2-187

Lineage for d2h1ta1 (2h1t A:2-187)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.178: Spiral beta-roll [159274] (1 superfamily)
   a large 15-stranded beta-sheet rolled about a single helix core; overlapping edges form a sandwich-like structure; topological similarity to the LolA-like fold (89391)

4. Superfamily b.178.1: PA1994-like [159275] (1 family)
   automatically mapped to Pfam PF06475

5. Family b.178.1.1: PA1994-like [159276] (1 protein)
   Pfam PF06475; DUF1089

6. Protein Hypothetical protein PA1994 [159277] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159278] (1 PDB entry)
   Uniprot Q9I2B5 2-187

8. Domain d2h1ta1: 2h1t A:2-187 [147215]
   N-terminal strand-swapped dimer
   complexed with edo, mpd

Details for d2h1ta1

PDB Entry: 2h1t, 1.8 Å

PDB Description: crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2h1ta1:

Sequence; same for both SEQRES and ATOM records:

>d2h1ta1 b.178.1.1 (A:2-187) Hypothetical protein PA1994 {Pseudomonas aeruginosa [TaxId: 287]}
srdrlytwaglwrspssswealrleddqaesqlrapdersglpyqldyrlrwdadwhlre
avfhvesetgvrklhlladgrghwqdgdgealpafdgcldidiwpspftntfpirrlgla
dgqraeiralyieapaleprsmrqaytrldashylyenlegsafkavllvdeqglvidyp
glfqrl

Timeline for d2h1ta1:

• d2h1ta1 first appeared in SCOP 1.75
  
• d2h1ta1 appears in SCOPe 2.05
  
• d2h1ta1 appears in SCOPe 2.07
  
• d2h1ta1 appears in the current release, SCOPe 2.08