Lineage for d2h1ic1 (2h1i C:1-202)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842390Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (4 proteins)
  6. 842395Protein Carboxylesterase [53548] (2 species)
  7. 842396Species Bacillus cereus [TaxId:1396] [159737] (1 PDB entry)
    Uniprot Q81AD5 1-202
    similar fold and function to the Pseudomonas fluorescens enzyme despite low sequence identity
  8. 842399Domain d2h1ic1: 2h1i C:1-202 [147212]
    automatically matched to 2H1I A:1-202
    complexed with ca, cl, zn

Details for d2h1ic1

PDB Entry: 2h1i (more details), 2.8 Å

PDB Description: Crystal Structure of the Bacillus cereus Carboxylesterase
PDB Compounds: (C:) carboxylesterase

SCOP Domain Sequences for d2h1ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ic1 c.69.1.14 (C:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}
mmkhvfqkgkdtskpvllllhgtggneldllplaeivdseasvlsvrgnvlengmprffr
rlaegifdeedlifrtkelnefldeaakeykfdrnnivaigysnganiaasllfhyenal
kgavlhhpmvprrgmqlanlagksvfiaagtndpicssaeseelkvllenananvtmhwe
nrghqltmgevekakewydkaf

SCOP Domain Coordinates for d2h1ic1:

Click to download the PDB-style file with coordinates for d2h1ic1.
(The format of our PDB-style files is described here.)

Timeline for d2h1ic1: