SCOPe 2.07: Domain d2h1ib2: 2h1i B:1-202

Lineage for d2h1ib2 (2h1i B:1-202)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)

6. Protein Carboxylesterase [53548] (2 species)

7. Species Bacillus cereus [TaxId:1396] [159737] (1 PDB entry)
   Uniprot Q81AD5 1-202
   similar fold and function to the Pseudomonas fluorescens enzyme despite low sequence identity

8. Domain d2h1ib2: 2h1i B:1-202 [147211]
   Other proteins in same PDB: d2h1ia2, d2h1ib3, d2h1ic3
   automated match to d2h1ia1
   complexed with ca, cl, zn

Details for d2h1ib2

PDB Entry: 2h1i, 2.8 Å

PDB Description: Crystal Structure of the Bacillus cereus Carboxylesterase

PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d2h1ib2:

Sequence; same for both SEQRES and ATOM records:

>d2h1ib2 c.69.1.14 (B:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}
mmkhvfqkgkdtskpvllllhgtggneldllplaeivdseasvlsvrgnvlengmprffr
rlaegifdeedlifrtkelnefldeaakeykfdrnnivaigysnganiaasllfhyenal
kgavlhhpmvprrgmqlanlagksvfiaagtndpicssaeseelkvllenananvtmhwe
nrghqltmgevekakewydkaf

Timeline for d2h1ib2:

• d2h1ib2 first appeared in SCOP 1.75, called d2h1ib1
  
• d2h1ib2 appears in SCOPe 2.06
  
• d2h1ib2 appears in the current release, SCOPe 2.08