SCOP 1.75: Domain d2h1ia1: 2h1i A:1-202

Lineage for d2h1ia1 (2h1i A:1-202)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (4 proteins)

6. Protein Carboxylesterase [53548] (2 species)

7. Species Bacillus cereus [TaxId:1396] [159737] (1 PDB entry)
   Uniprot Q81AD5 1-202
   similar fold and function to the Pseudomonas fluorescens enzyme despite low sequence identity

8. Domain d2h1ia1: 2h1i A:1-202 [147210]
   complexed with ca, cl, zn

Details for d2h1ia1

PDB Entry: 2h1i, 2.8 Å

PDB Description: Crystal Structure of the Bacillus cereus Carboxylesterase

PDB Compounds: (A:) carboxylesterase

SCOP Domain Sequences for d2h1ia1:

Sequence; same for both SEQRES and ATOM records:

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}
mmkhvfqkgkdtskpvllllhgtggneldllplaeivdseasvlsvrgnvlengmprffr
rlaegifdeedlifrtkelnefldeaakeykfdrnnivaigysnganiaasllfhyenal
kgavlhhpmvprrgmqlanlagksvfiaagtndpicssaeseelkvllenananvtmhwe
nrghqltmgevekakewydkaf

Timeline for d2h1ia1:

• d2h1ia1 is new in SCOP 1.75
  
• d2h1ia1 appears in SCOPe 2.01
  
• d2h1ia1 appears in the current release, SCOPe 2.08