Lineage for d2gzra1 (2gzr A:41-305)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136016Family c.69.1.38: IroE-like [159750] (1 protein)
  6. 2136017Protein Enterobactin and salmochelin hydrolase IroE [159751] (1 species)
  7. 2136018Species Escherichia coli [TaxId:562] [159752] (2 PDB entries)
    Uniprot Q6KD95 41-305
  8. 2136020Domain d2gzra1: 2gzr A:41-305 [147208]

Details for d2gzra1

PDB Entry: 2gzr (more details), 2.3 Å

PDB Description: Enterobactin and Salmochelin Hydrolase IroE
PDB Compounds: (A:) IroE protein

SCOPe Domain Sequences for d2gzra1:

Sequence, based on SEQRES records: (download)

>d2gzra1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}
pniadkgsvfyhfsatsfdsvdgtrhyrvwtavpnttapasgypilymldgnavmdrldd
ellkqlsektppvivavgyqtnlpfdlnsraydytpaaesrktdlhsgrfsrksggsnnf
rqlletriapkveqglnidrqrrglwghsygglfvldswlsssyfrsyysaspslgrgyd
allsrvtaveplqfctkhlaimegsatqgdnrethavgvlskihttltilkdkgvnavfw
dfpnlghgpmfnasfrqalldisge

Sequence, based on observed residues (ATOM records): (download)

>d2gzra1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]}
pniadkgsvfyhfsatsfdsvdgtrhyrvwtavpnttapasgypilymldgnavmdrldd
ellkqlsektppvivavgyqtnlpfdlnsraydytpaaerksggsnnfrqlletriapkv
eqglnidrqrrglwghsygglfvldswlsssyfrsyysaspslgrgydallsrvtavepl
qfctkhlaimegsagvlskihttltilkdkgvnavfwdfpnlghgpmfnasfrqalldis
ge

SCOPe Domain Coordinates for d2gzra1:

Click to download the PDB-style file with coordinates for d2gzra1.
(The format of our PDB-style files is described here.)

Timeline for d2gzra1: