SCOPe 2.04: Domain d2gzje_: 2gzj E:

Lineage for d2gzje_ (2gzj E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)

8. Domain d2gzje_: 2gzj E: [147206]
   Other proteins in same PDB: d2gzjb_, d2gzjf_
   automated match to d1e0ha_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2gzje_

PDB Entry: 2gzj, 1.6 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (d51a)

PDB Compounds: (E:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gzje_:

Sequence; same for both SEQRES and ATOM records:

>d2gzje_ a.28.2.1 (E:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

Timeline for d2gzje_:

• d2gzje_ first appeared in SCOP 1.75, called d2gzje1
  
• d2gzje_ appears in SCOPe 2.03
  
• d2gzje_ appears in SCOPe 2.05
  
• d2gzje_ appears in the current release, SCOPe 2.08