Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) automatically mapped to Pfam PF01320 |
Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
Protein ImmE9 protein (Im9) [47351] (1 species) |
Species Escherichia coli [TaxId:562] [47352] (18 PDB entries) |
Domain d2gzja_: 2gzj A: [147204] Other proteins in same PDB: d2gzjb_, d2gzjf_ automated match to d1e0ha_ protein/DNA complex; complexed with po4, zn; mutant |
PDB Entry: 2gzj (more details), 1.6 Å
SCOPe Domain Sequences for d2gzja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzja_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]} lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd spsgivntvkqwraangksgfkq
Timeline for d2gzja_: