Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.1: HNH-motif [54061] (3 proteins) |
Protein DNase domain of colicin E9 [54064] (1 species) |
Species Escherichia coli [TaxId:562] [54065] (15 PDB entries) Uniprot P09883 456-581 |
Domain d2gzeb_: 2gze B: [147200] Other proteins in same PDB: d2gzea_ automated match to d1fsjb_ complexed with po4, zn; mutant |
PDB Entry: 2gze (more details), 1.8 Å
SCOPe Domain Sequences for d2gzeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzeb_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]} eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhhdkpisqggevydmdnirv ttpkrhidihrg
Timeline for d2gzeb_: