Lineage for d2gz4c_ (2gz4 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2018903Family a.211.1.1: HD domain [101340] (14 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2018921Protein Hypothetical protein Atu1052 [158725] (1 species)
  7. 2018922Species Agrobacterium tumefaciens [TaxId:358] [158726] (1 PDB entry)
    Uniprot Q8UGI5 6-205
  8. 2018925Domain d2gz4c_: 2gz4 C: [147198]
    automated match to d2gz4a1

Details for d2gz4c_

PDB Entry: 2gz4 (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function ATU1052 from Agrobacterium tumefaciens
PDB Compounds: (C:) Hypothetical protein Atu1052

SCOPe Domain Sequences for d2gz4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz4c_ a.211.1.1 (C:) Hypothetical protein Atu1052 {Agrobacterium tumefaciens [TaxId: 358]}
sprawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivet
ifcrmcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglp
phasrelkdrikkadtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaq
rlfiarfeaietlrvt

SCOPe Domain Coordinates for d2gz4c_:

Click to download the PDB-style file with coordinates for d2gz4c_.
(The format of our PDB-style files is described here.)

Timeline for d2gz4c_: