SCOPe 2.07: Domain d2gz4b_: 2gz4 B:

Lineage for d2gz4b_ (2gz4 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.1: HD domain [101340] (14 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Hypothetical protein Atu1052 [158725] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [158726] (1 PDB entry)
   Uniprot Q8UGI5 6-205

8. Domain d2gz4b_: 2gz4 B: [147197]
   automated match to d2gz4a1

Details for d2gz4b_

PDB Entry: 2gz4, 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function ATU1052 from Agrobacterium tumefaciens

PDB Compounds: (B:) Hypothetical protein Atu1052

SCOPe Domain Sequences for d2gz4b_:

Sequence; same for both SEQRES and ATOM records:

>d2gz4b_ a.211.1.1 (B:) Hypothetical protein Atu1052 {Agrobacterium tumefaciens [TaxId: 358]}
sprawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivet
ifcrmcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglp
phasrelkdrikkadtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaq
rlfiarfeaietlrvtrt

Timeline for d2gz4b_:

• d2gz4b_ first appeared in SCOP 1.75, called d2gz4b1
  
• d2gz4b_ appears in SCOPe 2.06
  
• d2gz4b_ appears in the current release, SCOPe 2.08