SCOPe 2.05: Domain d2gxfb_: 2gxf B:

Lineage for d2gxfb_ (2gxf B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.22: YybH-like [160015] (1 protein)
   PfamB PB052627
   automatically mapped to Pfam PF13474

6. Protein Hypothetical protein YybH [160016] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160017] (1 PDB entry)
   Uniprot P37496 1-128

8. Domain d2gxfb_: 2gxf B: [147192]
   automated match to d2gxfa1
   complexed with mes

Details for d2gxfb_

PDB Entry: 2gxf, 3.1 Å

PDB Description: X-Ray Crystal Structure of Protein YybH from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR506.

PDB Compounds: (B:) Hypothetical protein yybH

SCOPe Domain Sequences for d2gxfb_:

Sequence, based on SEQRES records:

>d2gxfb_ d.17.4.22 (B:) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldsdkkdseyamerratyvfkknaqgewlcvidn
sygtdlig

Sequence, based on observed residues (ATOM records):

>d2gxfb_ d.17.4.22 (B:) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldmerratyvfkknaqgewlcvidnsygtdlig

Timeline for d2gxfb_:

• d2gxfb_ first appeared in SCOP 1.75, called d2gxfb1
  
• d2gxfb_ appears in SCOPe 2.04
  
• d2gxfb_ appears in SCOPe 2.06
  
• d2gxfb_ appears in the current release, SCOPe 2.08