Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.22: YybH-like [160015] (1 protein) PfamB PB052627 automatically mapped to Pfam PF13474 |
Protein Hypothetical protein YybH [160016] (1 species) |
Species Bacillus subtilis [TaxId:1423] [160017] (1 PDB entry) Uniprot P37496 1-128 |
Domain d2gxfb_: 2gxf B: [147192] automated match to d2gxfa1 complexed with mes |
PDB Entry: 2gxf (more details), 3.1 Å
SCOPe Domain Sequences for d2gxfb_:
Sequence, based on SEQRES records: (download)
>d2gxfb_ d.17.4.22 (B:) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn hhivptqgkmilleagdtvlvlsqtlldsdkkdseyamerratyvfkknaqgewlcvidn sygtdlig
>d2gxfb_ d.17.4.22 (B:) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn hhivptqgkmilleagdtvlvlsqtlldmerratyvfkknaqgewlcvidnsygtdlig
Timeline for d2gxfb_: