SCOP 1.75: Domain d2gxfb1: 2gxf B:1-128

Lineage for d2gxfb1 (2gxf B:1-128)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.22: YybH-like [160015] (1 protein)
   PfamB PB052627

6. Protein Hypothetical protein YybH [160016] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160017] (1 PDB entry)
   Uniprot P37496 1-128

8. Domain d2gxfb1: 2gxf B:1-128 [147192]
   automatically matched to 2GXF A:1-128
   complexed with mes

Details for d2gxfb1

PDB Entry: 2gxf, 3.1 Å

PDB Description: X-Ray Crystal Structure of Protein YybH from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR506.

PDB Compounds: (B:) Hypothetical protein yybH

SCOP Domain Sequences for d2gxfb1:

Sequence, based on SEQRES records:

>d2gxfb1 d.17.4.22 (B:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldsdkkdseyamerratyvfkknaqgewlcvidn
sygtdlig

Sequence, based on observed residues (ATOM records):

>d2gxfb1 d.17.4.22 (B:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldmerratyvfkknaqgewlcvidnsygtdlig

Timeline for d2gxfb1:

• d2gxfb1 is new in SCOP 1.75
  
• d2gxfb1 appears in SCOPe 2.01
  
• d2gxfb1 appears in the current release, SCOPe 2.08, called d2gxfb_