Lineage for d2gxfa1 (2gxf A:1-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937080Family d.17.4.22: YybH-like [160015] (1 protein)
    PfamB PB052627
    automatically mapped to Pfam PF13474
  6. 2937081Protein Hypothetical protein YybH [160016] (1 species)
  7. 2937082Species Bacillus subtilis [TaxId:1423] [160017] (1 PDB entry)
    Uniprot P37496 1-128
  8. 2937083Domain d2gxfa1: 2gxf A:1-128 [147191]
    complexed with mes

Details for d2gxfa1

PDB Entry: 2gxf (more details), 3.1 Å

PDB Description: X-Ray Crystal Structure of Protein YybH from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR506.
PDB Compounds: (A:) Hypothetical protein yybH

SCOPe Domain Sequences for d2gxfa1:

Sequence, based on SEQRES records: (download)

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldsdkkdseyamerratyvfkknaqgewlcvidn
sygtdlig

Sequence, based on observed residues (ATOM records): (download)

>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]}
meqqlkdiisacdlaiqnedfdtlmnyysedavlvvkpgmiargkeeikkafitianyfn
hhivptqgkmilleagdtvlvlsqtlldmerratyvfkknaqgewlcvidnsygtdlig

SCOPe Domain Coordinates for d2gxfa1:

Click to download the PDB-style file with coordinates for d2gxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2gxfa1: