SCOPe 2.08: Domain d2gw6a1: 2gw6 A:2-123

Lineage for d2gw6a1 (2gw6 A:2-123)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family)

5. Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)

6. Protein tRNA-splicing endonuclease subunit Sen15 [159610] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159611] (1 PDB entry)
   Uniprot Q8WW01 36-157

8. Domain d2gw6a1: 2gw6 A:2-123 [147189]
   Other proteins in same PDB: d2gw6a2, d2gw6b3

Details for d2gw6a1

PDB Entry: 2gw6

PDB Description: nmr structure of the human trna endonuclease sen15 subunit

PDB Compounds: (A:) tRNA-splicing endonuclease subunit Sen15

SCOPe Domain Sequences for d2gw6a1:

Sequence; same for both SEQRES and ATOM records:

>d2gw6a1 c.52.2.1 (A:2-123) tRNA-splicing endonuclease subunit Sen15 {Human (Homo sapiens) [TaxId: 9606]}
edawmgthpkylemmeldigdatqvyvaflvyldlmeskswhevncvglpelqliclvgt
eiegeglqtvvptpitaslshnrireilkasrklqgdpdlpmsftlaivesdstivyykl
td

Timeline for d2gw6a1:

• d2gw6a1 first appeared in SCOP 1.75
  
• d2gw6a1 appears in SCOPe 2.07