SCOPe 2.07: Domain d2gvia1: 2gvi A:1-168

Lineage for d2gvia1 (2gvi A:1-168)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.3: FwdE-like [143555] (1 family)
   contains extra N-terminal and C-terminal structures
   automatically mapped to Pfam PF02663

5. Family d.81.3.1: FwdE-like [143556] (2 proteins)
   Pfam PF02663; Tungsten formylmethanofuran dehydrogenase, subunit E, FwdE, is a stand-alone domain of this fold

6. Protein Uncharacterized protein Ta1109 [160525] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [160526] (1 PDB entry)
   Uniprot Q9HJ63 1-168

8. Domain d2gvia1: 2gvi A:1-168 [147187]
   Other proteins in same PDB: d2gvia2
   complexed with acy, edo, unl, zn

Details for d2gvia1

PDB Entry: 2gvi, 1.87 Å

PDB Description: Crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 A resolution

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2gvia1:

Sequence; same for both SEQRES and ATOM records:

>d2gvia1 d.81.3.1 (A:1-168) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]}
meklnfgipewafefhghkcpympmgyragsyalkiaglekekdhrtyllsemspedmng
cfndgaqaatgctygkglfsllgygklalilyrpgrkairvhvrnsfmdelstrasdffr
yrkqgyepseipagaidpvlewissledeeifeyreidgftfepvkkn

Timeline for d2gvia1:

• d2gvia1 first appeared in SCOP 1.75
  
• d2gvia1 appears in SCOPe 2.06
  
• d2gvia1 appears in the current release, SCOPe 2.08