SCOPe 2.07: Domain d2gukb_: 2guk B:

Lineage for d2gukb_ (2guk B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.360: PG1857-like [160447] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha(3); 3 layers, a/b/a; antiparallel beta-sheet, order: 132

4. Superfamily d.360.1: PG1857-like [160448] (1 family)
   automatically mapped to Pfam PF09633

5. Family d.360.1.1: PG1857-like [160449] (1 protein)
   Pfam PF09633; DUF2023

6. Protein Hypothetical protein PG1857 [160450] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [160451] (1 PDB entry)
   Uniprot Q7MTT4 4-114

8. Domain d2gukb_: 2guk B: [147183]
   automated match to d2guka1

Details for d2gukb_

PDB Entry: 2guk, 1.91 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function from Porphyromonas gingivalis

PDB Compounds: (B:) hypothetical protein PG1857

SCOPe Domain Sequences for d2gukb_:

Sequence; same for both SEQRES and ATOM records:

>d2gukb_ d.360.1.1 (B:) Hypothetical protein PG1857 {Porphyromonas gingivalis [TaxId: 837]}
lnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertnlf
fgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns

Timeline for d2gukb_:

• d2gukb_ first appeared in SCOP 1.75, called d2gukb1
  
• d2gukb_ appears in SCOPe 2.06
  
• d2gukb_ appears in the current release, SCOPe 2.08