Lineage for d2gukb_ (2guk B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053951Fold d.360: PG1857-like [160447] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha(3); 3 layers, a/b/a; antiparallel beta-sheet, order: 132
  4. 1053952Superfamily d.360.1: PG1857-like [160448] (1 family) (S)
  5. 1053953Family d.360.1.1: PG1857-like [160449] (1 protein)
    Pfam PF09633; DUF2023
  6. 1053954Protein Hypothetical protein PG1857 [160450] (1 species)
  7. 1053955Species Porphyromonas gingivalis [TaxId:837] [160451] (1 PDB entry)
    Uniprot Q7MTT4 4-114
  8. 1053957Domain d2gukb_: 2guk B: [147183]
    automated match to d2guka1

Details for d2gukb_

PDB Entry: 2guk (more details), 1.91 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function from Porphyromonas gingivalis
PDB Compounds: (B:) hypothetical protein PG1857

SCOPe Domain Sequences for d2gukb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gukb_ d.360.1.1 (B:) Hypothetical protein PG1857 {Porphyromonas gingivalis [TaxId: 837]}
lnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertnlf
fgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns

SCOPe Domain Coordinates for d2gukb_:

Click to download the PDB-style file with coordinates for d2gukb_.
(The format of our PDB-style files is described here.)

Timeline for d2gukb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2guka1