Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.360: PG1857-like [160447] (1 superfamily) alpha-beta-alpha-beta(2)-alpha(3); 3 layers, a/b/a; antiparallel beta-sheet, order: 132 |
Superfamily d.360.1: PG1857-like [160448] (1 family) |
Family d.360.1.1: PG1857-like [160449] (1 protein) Pfam PF09633; DUF2023 |
Protein Hypothetical protein PG1857 [160450] (1 species) |
Species Porphyromonas gingivalis [TaxId:837] [160451] (1 PDB entry) Uniprot Q7MTT4 4-114 |
Domain d2gukb1: 2guk B:6-114 [147183] automatically matched to 2GUK A:4-114 |
PDB Entry: 2guk (more details), 1.91 Å
SCOP Domain Sequences for d2gukb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gukb1 d.360.1.1 (B:6-114) Hypothetical protein PG1857 {Porphyromonas gingivalis [TaxId: 837]} lnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertnlf fgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrk
Timeline for d2gukb1: