Lineage for d2guka1 (2guk A:4-114)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882950Fold d.360: PG1857-like [160447] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha(3); 3 layers, a/b/a; antiparallel beta-sheet, order: 132
  4. 882951Superfamily d.360.1: PG1857-like [160448] (1 family) (S)
  5. 882952Family d.360.1.1: PG1857-like [160449] (1 protein)
    Pfam PF09633; DUF2023
  6. 882953Protein Hypothetical protein PG1857 [160450] (1 species)
  7. 882954Species Porphyromonas gingivalis [TaxId:837] [160451] (1 PDB entry)
    Uniprot Q7MTT4 4-114
  8. 882955Domain d2guka1: 2guk A:4-114 [147182]

Details for d2guka1

PDB Entry: 2guk (more details), 1.91 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function from Porphyromonas gingivalis
PDB Compounds: (A:) hypothetical protein PG1857

SCOP Domain Sequences for d2guka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guka1 d.360.1.1 (A:4-114) Hypothetical protein PG1857 {Porphyromonas gingivalis [TaxId: 837]}
qtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertn
lffgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrk

SCOP Domain Coordinates for d2guka1:

Click to download the PDB-style file with coordinates for d2guka1.
(The format of our PDB-style files is described here.)

Timeline for d2guka1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gukb1