![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
![]() | Superfamily b.106.1: Phage tail proteins [69279] (4 families) ![]() |
![]() | Family b.106.1.3: XkdM-like [159185] (1 protein) Pfam PF09393; DUF2001 |
![]() | Protein Phage-like element PBSX protein XkdM [159186] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159187] (1 PDB entry) Uniprot P54332 5-143 |
![]() | Domain d2gujb_: 2guj B: [147181] automated match to d2guja1 |
PDB Entry: 2guj (more details), 3 Å
SCOPe Domain Sequences for d2gujb_:
Sequence, based on SEQRES records: (download)
>d2gujb_ b.106.1.3 (B:) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]} aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldvdse aleeevpftfedfdvpeklsdtf
>d2gujb_ b.106.1.3 (B:) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]} aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldeeev pftfedfdvpeklsdtf
Timeline for d2gujb_: