SCOPe 2.07: Domain d2guja1: 2guj A:5-143

Lineage for d2guja1 (2guj A:5-143)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (4 families)

5. Family b.106.1.3: XkdM-like [159185] (1 protein)
   Pfam PF09393; DUF2001

6. Protein Phage-like element PBSX protein XkdM [159186] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159187] (1 PDB entry)
   Uniprot P54332 5-143

8. Domain d2guja1: 2guj A:5-143 [147180]

Details for d2guja1

PDB Entry: 2guj, 3 Å

PDB Description: Three dimensional structure of the protein P54332 from Bacillus Subtilis. Northeast Structural Genomics Consortium target sr353.

PDB Compounds: (A:) Phage-like element PBSX protein xkdM

SCOPe Domain Sequences for d2guja1:

Sequence, based on SEQRES records:

>d2guja1 b.106.1.3 (A:5-143) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]}
aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy
kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldvdse
aleeevpftfedfdvpekl

Sequence, based on observed residues (ATOM records):

>d2guja1 b.106.1.3 (A:5-143) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]}
aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy
kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldeeev
pftfedfdvpekl

Timeline for d2guja1:

• d2guja1 first appeared in SCOP 1.75
  
• d2guja1 appears in SCOPe 2.06
  
• d2guja1 appears in the current release, SCOPe 2.08