Lineage for d2guja1 (2guj A:5-143)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074918Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2074919Superfamily b.106.1: Phage tail proteins [69279] (3 families) (S)
  5. 2074963Family b.106.1.3: XkdM-like [159185] (1 protein)
    Pfam PF09393; DUF2001
  6. 2074964Protein Phage-like element PBSX protein XkdM [159186] (1 species)
  7. 2074965Species Bacillus subtilis [TaxId:1423] [159187] (1 PDB entry)
    Uniprot P54332 5-143
  8. 2074966Domain d2guja1: 2guj A:5-143 [147180]

Details for d2guja1

PDB Entry: 2guj (more details), 3 Å

PDB Description: Three dimensional structure of the protein P54332 from Bacillus Subtilis. Northeast Structural Genomics Consortium target sr353.
PDB Compounds: (A:) Phage-like element PBSX protein xkdM

SCOPe Domain Sequences for d2guja1:

Sequence, based on SEQRES records: (download)

>d2guja1 b.106.1.3 (A:5-143) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]}
aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy
kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldvdse
aleeevpftfedfdvpekl

Sequence, based on observed residues (ATOM records): (download)

>d2guja1 b.106.1.3 (A:5-143) Phage-like element PBSX protein XkdM {Bacillus subtilis [TaxId: 1423]}
aqntisgkegrlfldgeemahiktfeanveknksevnimgrrmtghkttgangtgtatfy
kvtskfvllmmdyvkkgsdpyftlqavlddqssgrgtervtlydvnfdsakiasldeeev
pftfedfdvpekl

SCOPe Domain Coordinates for d2guja1:

Click to download the PDB-style file with coordinates for d2guja1.
(The format of our PDB-style files is described here.)

Timeline for d2guja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gujb_