SCOPe 2.06: Domain d2gu3a1: 2gu3 A:99-161

Lineage for d2gu3a1 (2gu3 A:99-161)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.6: PepSY-like [159955] (1 protein)
   Pfam PF03413; Peptidase propeptide and YPEB domain

6. Protein Uncharacterized protein YpmB [159956] (1 species)
   duplication; consist of two similar domains

7. Species Bacillus subtilis [TaxId:1423] [159957] (1 PDB entry)
   Uniprot P54396 34-98! Uniprot P54396 99-161

8. Domain d2gu3a1: 2gu3 A:99-161 [147178]
   complexed with ni

Details for d2gu3a1

PDB Entry: 2gu3, 1.74 Å

PDB Description: YpmB protein from Bacillus subtilis

PDB Compounds: (A:) YpmB protein

SCOPe Domain Sequences for d2gu3a1:

Sequence; same for both SEQRES and ATOM records:

>d2gu3a1 d.17.1.6 (A:99-161) Uncharacterized protein YpmB {Bacillus subtilis [TaxId: 1423]}
gisedkaakiikdeglvskqkevhlaregnvllwevtyldkegqyslsyvdfttgkilkn
itp

Timeline for d2gu3a1:

• d2gu3a1 first appeared in SCOP 1.75
  
• d2gu3a1 appears in SCOPe 2.05
  
• d2gu3a1 appears in SCOPe 2.07
  
• d2gu3a1 appears in the current release, SCOPe 2.08