Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.6: PepSY-like [159955] (1 protein) Pfam PF03413; Peptidase propeptide and YPEB domain |
Protein Uncharacterized protein YpmB [159956] (1 species) duplication; consist of two similar domains |
Species Bacillus subtilis [TaxId:1423] [159957] (1 PDB entry) Uniprot P54396 34-98! Uniprot P54396 99-161 |
Domain d2gu3a1: 2gu3 A:99-161 [147178] complexed with ni |
PDB Entry: 2gu3 (more details), 1.74 Å
SCOPe Domain Sequences for d2gu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu3a1 d.17.1.6 (A:99-161) Uncharacterized protein YpmB {Bacillus subtilis [TaxId: 1423]} gisedkaakiikdeglvskqkevhlaregnvllwevtyldkegqyslsyvdfttgkilkn itp
Timeline for d2gu3a1: