SCOPe 2.08: Domain d2gu2a1: 2gu2 A:4-310

Lineage for d2gu2a1 (2gu2 A:4-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
   Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)

6. Protein Aspartoacylase AspA [159649] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159650] (1 PDB entry)
   Uniprot Q6AZ03 4-310

8. Domain d2gu2a1: 2gu2 A:4-310 [147177]
   complexed with so4, zn

Details for d2gu2a1

PDB Entry: 2gu2, 1.81 Å

PDB Description: crystal structure of an aspartoacylase from rattus norvegicus

PDB Compounds: (A:) Aspa protein

SCOPe Domain Sequences for d2gu2a1:

Sequence; same for both SEQRES and ATOM records:

>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctry
idcdlnrvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgc
tlilgdsgndfliqmfhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqph
gvlradildqmrrmlkhaldfiqrfnegkefppcaidvykimekvdyprnesgdvaavih
pnlqdqdwkplhpgdpvfvsldgkviplggdctvypvfvneaayyekkeafakttkltln
aksirst

Timeline for d2gu2a1:

• d2gu2a1 first appeared in SCOP 1.75
  
• d2gu2a1 appears in SCOPe 2.07