![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.7: AstE/AspA-like [142526] (3 proteins) Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229) |
![]() | Protein Aspartoacylase AspA [159649] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [159650] (1 PDB entry) Uniprot Q6AZ03 4-310 |
![]() | Domain d2gu2a1: 2gu2 A:4-310 [147177] complexed with so4, zn |
PDB Entry: 2gu2 (more details), 1.81 Å
SCOPe Domain Sequences for d2gu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Norway rat (Rattus norvegicus) [TaxId: 10116]} cvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctry idcdlnrvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgc tlilgdsgndfliqmfhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqph gvlradildqmrrmlkhaldfiqrfnegkefppcaidvykimekvdyprnesgdvaavih pnlqdqdwkplhpgdpvfvsldgkviplggdctvypvfvneaayyekkeafakttkltln aksirst
Timeline for d2gu2a1: