Lineage for d2gu2a1 (2gu2 A:4-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889922Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
    Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)
  6. 2889923Protein Aspartoacylase AspA [159649] (2 species)
  7. 2889935Species Norway rat (Rattus norvegicus) [TaxId:10116] [159650] (1 PDB entry)
    Uniprot Q6AZ03 4-310
  8. 2889936Domain d2gu2a1: 2gu2 A:4-310 [147177]
    complexed with so4, zn

Details for d2gu2a1

PDB Entry: 2gu2 (more details), 1.81 Å

PDB Description: crystal structure of an aspartoacylase from rattus norvegicus
PDB Compounds: (A:) Aspa protein

SCOPe Domain Sequences for d2gu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctry
idcdlnrvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgc
tlilgdsgndfliqmfhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqph
gvlradildqmrrmlkhaldfiqrfnegkefppcaidvykimekvdyprnesgdvaavih
pnlqdqdwkplhpgdpvfvsldgkviplggdctvypvfvneaayyekkeafakttkltln
aksirst

SCOPe Domain Coordinates for d2gu2a1:

Click to download the PDB-style file with coordinates for d2gu2a1.
(The format of our PDB-style files is described here.)

Timeline for d2gu2a1: