Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.7: YvfG-like [158388] (1 family) automatically mapped to Pfam PF09628 |
Family a.23.7.1: YvfG-like [158389] (1 protein) Pfam PF09628 |
Protein Hypothetical protein YvfG [158390] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158391] (2 PDB entries) Uniprot P71066 3-69 |
Domain d2gsvb_: 2gsv B: [147175] automated match to d2gsva1 complexed with so4 |
PDB Entry: 2gsv (more details), 1.9 Å
SCOPe Domain Sequences for d2gsvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsvb_ a.23.7.1 (B:) Hypothetical protein YvfG {Bacillus subtilis [TaxId: 1423]} selfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhlde aynkvkrg
Timeline for d2gsvb_: