SCOP 1.75: Domain d2gsva1: 2gsv A:3-69

Lineage for d2gsva1 (2gsv A:3-69)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.7: YvfG-like [158388] (1 family)

5. Family a.23.7.1: YvfG-like [158389] (1 protein)
   Pfam PF09628

6. Protein Hypothetical protein YvfG [158390] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158391] (2 PDB entries)
   Uniprot P71066 3-69

8. Domain d2gsva1: 2gsv A:3-69 [147174]
   complexed with so4

Details for d2gsva1

PDB Entry: 2gsv, 1.9 Å

PDB Description: x-ray crystal structure of protein yvfg from bacillus subtilis. northeast structural genomics consortium target sr478.

PDB Compounds: (A:) Hypothetical protein yvfG

SCOP Domain Sequences for d2gsva1:

Sequence; same for both SEQRES and ATOM records:

>d2gsva1 a.23.7.1 (A:3-69) Hypothetical protein YvfG {Bacillus subtilis [TaxId: 1423]}
elfsvpyfienlkqhiemnqsedkihamnsyyrsvvstlvqdqltknavvlkriqhldea
ynkvkrg

Timeline for d2gsva1:

• d2gsva1 is new in SCOP 1.75
  
• d2gsva1 appears in SCOPe 2.01
  
• d2gsva1 appears in the current release, SCOPe 2.08