Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel automatically mapped to Pfam PF05635 |
Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins) Pfam PF05635 |
Protein automated matches [190667] (1 species) not a true protein |
Species Xanthomonas campestris pv. campestris [TaxId:340] [187769] (1 PDB entry) |
Domain d2gscd_: 2gsc D: [147172] Other proteins in same PDB: d2gsca1 automated match to d2gsca1 |
PDB Entry: 2gsc (more details), 2.45 Å
SCOPe Domain Sequences for d2gscd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gscd_ a.29.16.1 (D:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]} rpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrstpd ysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr
Timeline for d2gscd_:
View in 3D Domains from other chains: (mouse over for more information) d2gsca1, d2gscb_, d2gscc_, d2gsce_ |