Lineage for d2gscd_ (2gsc D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732469Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) (S)
    IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel
    automatically mapped to Pfam PF05635
  5. 1732470Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
    Pfam PF05635
  6. 1732481Protein automated matches [190667] (1 species)
    not a true protein
  7. 1732482Species Xanthomonas campestris pv. campestris [TaxId:340] [187769] (1 PDB entry)
  8. 1732485Domain d2gscd_: 2gsc D: [147172]
    Other proteins in same PDB: d2gsca1
    automated match to d2gsca1

Details for d2gscd_

PDB Entry: 2gsc (more details), 2.45 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Cytosolic Protein Xcc0516 from Xanthomonas campestris
PDB Compounds: (D:) Putative uncharacterized protein XCC0516

SCOPe Domain Sequences for d2gscd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gscd_ a.29.16.1 (D:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
rpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrstpd
ysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr

SCOPe Domain Coordinates for d2gscd_:

Click to download the PDB-style file with coordinates for d2gscd_.
(The format of our PDB-style files is described here.)

Timeline for d2gscd_: