| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) ![]() IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel |
| Family a.29.16.1: IVS-encoded protein-like [158447] (2 proteins) Pfam PF05635 |
| Protein Uncharacterized protein XCC0516 [158448] (1 species) |
| Species Xanthomonas campestris pv. campestris [TaxId:340] [158449] (1 PDB entry) Uniprot Q8PD29 9-125 |
| Domain d2gscd1: 2gsc D:9-123 [147172] automatically matched to 2GSC A:9-125 |
PDB Entry: 2gsc (more details), 2.45 Å
SCOP Domain Sequences for d2gscd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gscd1 a.29.16.1 (D:9-123) Uncharacterized protein XCC0516 {Xanthomonas campestris pv. campestris [TaxId: 340]}
rpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrstpd
ysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr
Timeline for d2gscd1:
View in 3DDomains from other chains: (mouse over for more information) d2gsca1, d2gscb1, d2gscc1, d2gsce1 |