SCOP 1.75: Domain d2gscb1: 2gsc B:9-123

Lineage for d2gscb1 (2gsc B:9-123)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family)
   IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel

5. Family a.29.16.1: IVS-encoded protein-like [158447] (2 proteins)
   Pfam PF05635

6. Protein Uncharacterized protein XCC0516 [158448] (1 species)

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [158449] (1 PDB entry)
   Uniprot Q8PD29 9-125

8. Domain d2gscb1: 2gsc B:9-123 [147170]
   automatically matched to 2GSC A:9-125

Details for d2gscb1

PDB Entry: 2gsc, 2.45 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Cytosolic Protein Xcc0516 from Xanthomonas campestris

PDB Compounds: (B:) Putative uncharacterized protein XCC0516

SCOP Domain Sequences for d2gscb1:

Sequence; same for both SEQRES and ATOM records:

>d2gscb1 a.29.16.1 (B:9-123) Uncharacterized protein XCC0516 {Xanthomonas campestris pv. campestris [TaxId: 340]}
rpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrstpd
ysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr

Timeline for d2gscb1:

• d2gscb1 is new in SCOP 1.75
  
• d2gscb1 is called d2gscb_ in SCOPe 2.01
  
• d2gscb1 appears in the current release, SCOPe 2.08, called d2gscb_