Lineage for d2gscb_ (2gsc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2709022Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) (S)
    IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel
    automatically mapped to Pfam PF05635
  5. 2709023Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
    Pfam PF05635
  6. 2709034Protein automated matches [190667] (1 species)
    not a true protein
  7. 2709035Species Xanthomonas campestris pv. campestris [TaxId:340] [187769] (1 PDB entry)
  8. 2709036Domain d2gscb_: 2gsc B: [147170]
    Other proteins in same PDB: d2gsca1
    automated match to d2gsca1

Details for d2gscb_

PDB Entry: 2gsc (more details), 2.45 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Cytosolic Protein Xcc0516 from Xanthomonas campestris
PDB Compounds: (B:) Putative uncharacterized protein XCC0516

SCOPe Domain Sequences for d2gscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gscb_ a.29.16.1 (B:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
aqrpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrst
pdysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr

SCOPe Domain Coordinates for d2gscb_:

Click to download the PDB-style file with coordinates for d2gscb_.
(The format of our PDB-style files is described here.)

Timeline for d2gscb_: