Lineage for d2grrb_ (2grr B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279729Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 1279730Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 1279731Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 1279732Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 1279733Domain d2grrb_: 2grr B: [147168]
    Other proteins in same PDB: d2grra_
    automated match to d1kpsb_

Details for d2grrb_

PDB Entry: 2grr (more details), 1.3 Å

PDB Description: crystal structure of human rangap1-ubc9-d127s
PDB Compounds: (B:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2grrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grrb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d2grrb_:

Click to download the PDB-style file with coordinates for d2grrb_.
(The format of our PDB-style files is described here.)

Timeline for d2grrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2grra_