Lineage for d2grrb1 (2grr B:431-587)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) 
Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (1 protein) Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
Uniprot P46060 431-587! Uniprot P46060 432-587
Domain d2grrb1: 2grr B:431-587 [147168]
automatically matched to 2GRN B:431-587
mutant
Details for d2grrb1
PDB Entry: 2grr (more details), 1.3 Å
PDB Description: crystal structure of human rangap1-ubc9-d127s
PDB Compounds: (B:) ran gtpase-activating protein 1SCOP Domain Sequences for d2grrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv
SCOP Domain Coordinates for d2grrb1:
Click to download the PDB-style file with coordinates for d2grrb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2grrb1:
- d2grrb1 is new in SCOP 1.75
- d2grrb1 is called d2grrb_ in SCOPe 2.01
- d2grrb1 appears in the current release, SCOPe 2.08, called d2grrb_
View in 3D