| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() |
| Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
| Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69102] (5 PDB entries) |
| Domain d2grqb_: 2grq B: [147167] Other proteins in same PDB: d2grqa_ automated match to d1kpsb_ |
PDB Entry: 2grq (more details), 1.7 Å
SCOPe Domain Sequences for d2grqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grqb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d2grqb_: