SCOPe 2.07: Domain d2grpb_: 2grp B:

Lineage for d2grpb_ (2grp B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)
   automatically mapped to Pfam PF07834

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
   Uniprot P46060 431-587! Uniprot P46060 432-587

8. Domain d2grpb_: 2grp B: [147166]
   Other proteins in same PDB: d2grpa_
   automated match to d1kpsb_

Details for d2grpb_

PDB Entry: 2grp, 2.05 Å

PDB Description: crystal structure of human rangap1-ubc9-y87a

PDB Compounds: (B:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2grpb_:

Sequence; same for both SEQRES and ATOM records:

>d2grpb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d2grpb_:

• d2grpb_ first appeared in SCOP 1.75, called d2grpb1
  
• d2grpb_ appears in SCOPe 2.06
  
• d2grpb_ appears in the current release, SCOPe 2.08