Lineage for d2grpb_ (2grp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334344Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2334345Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2334346Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 2334347Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 2334352Domain d2grpb_: 2grp B: [147166]
    Other proteins in same PDB: d2grpa_
    automated match to d1kpsb_

Details for d2grpb_

PDB Entry: 2grp (more details), 2.05 Å

PDB Description: crystal structure of human rangap1-ubc9-y87a
PDB Compounds: (B:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2grpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grpb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d2grpb_:

Click to download the PDB-style file with coordinates for d2grpb_.
(The format of our PDB-style files is described here.)

Timeline for d2grpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2grpa_