![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() automatically mapped to Pfam PF07834 |
![]() | Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
![]() | Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries) Uniprot P46060 431-587! Uniprot P46060 432-587 |
![]() | Domain d2grpb_: 2grp B: [147166] Other proteins in same PDB: d2grpa_ automated match to d1kpsb_ |
PDB Entry: 2grp (more details), 2.05 Å
SCOPe Domain Sequences for d2grpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grpb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy fpkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d2grpb_: