SCOPe 2.01: Domain d2grob_: 2gro B:

Lineage for d2grob_ (2gro B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family)

5. Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)

6. Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69102] (5 PDB entries)

8. Domain d2grob_: 2gro B: [147165]
   Other proteins in same PDB: d2groa_
   automated match to d1kpsb_

Details for d2grob_

PDB Entry: 2gro, 1.7 Å

PDB Description: crystal structure of human rangap1-ubc9-n85q

PDB Compounds: (B:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2grob_:

Sequence; same for both SEQRES and ATOM records:

>d2grob_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv

Timeline for d2grob_:

• d2grob_ first appeared in SCOP 1.75, called d2grob1
  
• d2grob_ appears in SCOPe 2.02
  
• d2grob_ appears in the current release, SCOPe 2.08